SCOPe 2.08: Structural Classification of Proteins

PDB entry 1e7p

View 1e7p on RCSB PDB site
Description: quinol:fumarate reductase from wolinella succinogenes
Class: oxidoreductase
Keywords: oxidoreductase, succinate dehydrogenase, respiratory chain, citric acid cycle, flavoprotein, iron- sulphur protein iron- sulphur protein, dihaem cytochrome b
Deposited on 2000-09-01, released 2001-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Fumarate reductase flavoprotein subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdA, WS0831
Database cross-references and differences (RAF-indexed):
- Uniprot P17412 (0-End)
Domains in SCOPe 2.08: d1e7pa1, d1e7pa2, d1e7pa3
Chain 'B':
Compound: Fumarate reductase iron-sulfur subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdB, WS0830
Database cross-references and differences (RAF-indexed):
- Uniprot P17596 (0-238)
Domains in SCOPe 2.08: d1e7pb1, d1e7pb2
Chain 'C':
Compound: fumarate reductase cytochrome b subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdC, WS0832
Database cross-references and differences (RAF-indexed):
- Uniprot P17413 (0-End)
  - engineered mutation (65)
Domains in SCOPe 2.08: d1e7pc_
Chain 'D':
Compound: Fumarate reductase flavoprotein subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdA, WS0831
Database cross-references and differences (RAF-indexed):
- Uniprot P17412 (0-End)
Domains in SCOPe 2.08: d1e7pd1, d1e7pd2, d1e7pd3
Chain 'E':
Compound: Fumarate reductase iron-sulfur subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdB, WS0830
Database cross-references and differences (RAF-indexed):
- Uniprot P17596 (0-238)
Domains in SCOPe 2.08: d1e7pe1, d1e7pe2
Chain 'F':
Compound: fumarate reductase cytochrome b subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdC, WS0832
Database cross-references and differences (RAF-indexed):
- Uniprot P17413 (0-End)
  - engineered mutation (65)
Domains in SCOPe 2.08: d1e7pf_
Chain 'G':
Compound: Fumarate reductase flavoprotein subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdA, WS0831
Database cross-references and differences (RAF-indexed):
- Uniprot P17412 (0-End)
Domains in SCOPe 2.08: d1e7pg1, d1e7pg2, d1e7pg3
Chain 'H':
Compound: Fumarate reductase iron-sulfur subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdB, WS0830
Database cross-references and differences (RAF-indexed):
- Uniprot P17596 (0-238)
Domains in SCOPe 2.08: d1e7ph1, d1e7ph2
Chain 'I':
Compound: fumarate reductase cytochrome b subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdC, WS0832
Database cross-references and differences (RAF-indexed):
- Uniprot P17413 (0-End)
  - engineered mutation (65)
Domains in SCOPe 2.08: d1e7pi_
Chain 'J':
Compound: Fumarate reductase flavoprotein subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdA, WS0831
Database cross-references and differences (RAF-indexed):
- Uniprot P17412 (0-End)
Domains in SCOPe 2.08: d1e7pj1, d1e7pj2, d1e7pj3
Chain 'K':
Compound: Fumarate reductase iron-sulfur subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdB, WS0830
Database cross-references and differences (RAF-indexed):
- Uniprot P17596 (0-238)
Domains in SCOPe 2.08: d1e7pk1, d1e7pk2
Chain 'L':
Compound: fumarate reductase cytochrome b subunit
Species: Wolinella succinogenes [TaxId:844]
Gene: frdC, WS0832
Database cross-references and differences (RAF-indexed):
- Uniprot P17413 (0-End)
  - engineered mutation (65)
Domains in SCOPe 2.08: d1e7pl_
Heterogens: FAD, MLA, NA, FES, F3S, SF4, HEM, LMT

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1e7pA (A:)
mkvqycdslviggglaglraavatqqkglstivlslipvkrshsaaaqggmqaslgnskm
sdgdnedlhfmdtvkgsdwgcdqkvarmfvntapkairelaawgvpwtrihkgdrmaiin
aqkttiteedfrhglihsrdfggtkkwrtcytadatghtmlfavaneclklgvsiqdrke
aialihqdgkcygavvrdlvtgdiiayvakgtliatggygriyknttnavvcegtgtaia
letgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfmpdyepekkelas
rdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyfagidpaek
wapvlpmqhysmggirtdyrgeaklkglfsageaacwdmhgfnrlggnsvseavvagmiv
geyfaehcantqvdletktlekfvkgqeaymkslveskgtedvfkiknrmkdvmddnvgi
frdgphlekavkeleelykksknvgiknkrlhanpeleeayrvpmmlkvalcvakgaldr
tesrgahnredypkrddinwlnrtlaswpnpeqtlptleyealdvnemeiapgyrgygak
gnyienplsvkrqeeidkiqseleaagkdrhaiqealmpyelpakykarnerlgdk