PDB entry 1e7k

View 1e7k on RCSB PDB site
Description: crystal structure of the spliceosomal 15.5kd protein bound to a u4 snrna fragment
Class: RNA-binding protein
Keywords: splicing, RNA recognition motif, u4 snrna
Deposited on 2000-08-29, released 2001-02-19
The last revision prior to the SCOP 1.75 freeze date was dated 2001-02-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.216
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 15.5 kd RNA binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e7ka_
  • Chain 'B':
    Compound: 15.5 kd RNA binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1e7kb_
  • Chain 'C':
    Compound: RNA (5'-r(*gp*cp*cp*ap*ap*up*gp*ap*gp*gp*up*up*up* ap*up*cp*cp*gp*ap*gp*g*c(-3')
  • Chain 'D':
    Compound: RNA (5'-r(*gp*cp*cp*ap*ap*up*gp*ap*gp*gp*up*up*up* ap*up*cp*cp*gp*ap*gp*g*c(-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7kA (A:)
    mteadvnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaada
    epleiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiq
    qsierllv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7kA (A:)
    advnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaepl
    eiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsi
    erllv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e7kB (B:)
    mteadvnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaada
    epleiilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiq
    qsierllv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7kB (B:)
    vnpkaypladahltkklldlvqqscnykqlrkganeatktlnrgisefivmaadaeplei
    ilhlpllcedknvpyvfvrskqalgracgvsrpviacsvtikegsqlkqqiqsiqqsier
    llv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.