PDB entry 1e7d

View 1e7d on RCSB PDB site
Description: endonuclease vii (endovii) ffrom phage t4
Deposited on 2000-08-28, released 2001-05-04
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-04, with a file datestamp of 2001-05-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7dA (A:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7dB (B:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cnaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk