PDB entry 1e6r

View 1e6r on RCSB PDB site
Description: chitinase b from serratia marcescens wildtype in complex with inhibitor allosamidin
Deposited on 2000-08-22, released 2001-06-22
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-22, with a file datestamp of 2001-06-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6rA (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6rB (B:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva