PDB entry 1e6j

View 1e6j on RCSB PDB site
Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Deposited on 2000-08-18, released 2000-11-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-11, with a file datestamp of 2000-12-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.21
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jH (H:)
    evqlqqsgaelarpgasvkmsckasgytftsytmhwvkqrpgqglewigyinpssgysny
    nqkfkdkatltadkssstaymqlssltsedsavyycsrpvvrlgynfdywgqgstltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jL (L:)
    eivltqspaitaaslgqkvtitcsasssvsymhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltissmeaedaaiyycqqwnypftfgsgtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrn
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6jP (P:)
    vhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlk
    etineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiy
    krwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetll
    vqnanpdcktilkalgpaatleemmtacqg