PDB entry 1e6i

View 1e6i on RCSB PDB site
Description: Bromodomain from GCN5 complexed with acetylated H4 peptide
Deposited on 2000-08-18, released 2000-11-24
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-24, with a file datestamp of 2000-11-24.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1e6ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e6iA (A:)
    rgphdaaiqniltelqnhaaawpflqpvnkeevpdyydfikepmdlstmeiklesnkyqk
    medfiydarlvfnncrmyngentsyykyanrlekffnnkvkeipeyshlid