PDB entry 1e6b

View 1e6b on RCSB PDB site
Description: crystal structure of a zeta class glutathione s-transferase from arabidopsis thaliana
Deposited on 2000-08-10, released 2001-06-11
The last revision prior to the SCOP 1.65 freeze date was dated 2001-06-11, with a file datestamp of 2001-06-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.196
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6bA (A:)
    mansgeeklklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtv
    palvdgdvvindsfaiimyldekypeppllprdlhkravnyqamsivlsgiqphqnlavi
    ryieekinveektawvnnaitkgftalekllvncagkhatgdeiyladlflapqihgain
    rfqinmepyptlakcyesynelpafqnalpekqpdapssti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6bA (A:)
    klklysywrsscahrvrialalkgldyeyipvnllkgdqfdsdfkkinpmgtvpalvdgd
    vvindsfaiimyldekypeppllprdlhkravnyqamsivlsgiqptawvnnaitkgfta
    lekllvncagkhatgdeiyladlflapqihgainrfqinmepyptlakcyesynelpafq
    nalpekqpdapsst