PDB entry 1e5x

View 1e5x on RCSB PDB site
Description: structure of threonine synthase from arabidopsis thaliana
Class: threonine biosynthesis
Keywords: threonine biosynthesis, plp enzyme, s-adenosyl-methionine, allostery
Deposited on 2000-08-04, released 2001-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonine synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NUCLEAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39144 (Start-485)
      • modified residue (308)
      • modified residue (76)
      • modified residue (145)
      • modified residue (166)
      • modified residue (179)
      • modified residue (220)
      • modified residue (244)
      • modified residue (321)
      • modified residue (387)
      • modified residue (390)
      • modified residue (398)
      • modified residue (452)
      • modified residue (471)
    Domains in SCOPe 2.07: d1e5xa_
  • Chain 'B':
    Compound: threonine synthase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NUCLEAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q39144
      • modified residue (308)
      • modified residue (76)
      • modified residue (145)
      • modified residue (166)
      • modified residue (179)
      • modified residue (220)
      • modified residue (244)
      • modified residue (321)
      • modified residue (387)
      • modified residue (390)
      • modified residue (398)
      • modified residue (452)
      • modified residue (471)
    Domains in SCOPe 2.07: d1e5xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e5xA (A:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5xA (A:)
    ietavkpphrtednirdenavnpfsakyvpfnaapgstesysldeivyrglldvehdmea
    lkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerf
    gkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaal
    saycasagipsivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpiyl
    anslnslrlegqktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdri
    prmvcaqaananplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaqad
    stgmficphtgvaltalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmac
    rfsnppvdvkadfgavmdvlksylgsntlts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e5xB (B:)
    adgnnikapietavkpphrtednirdearrnrsnavnpfsakyvpfnaapgstesyslde
    ivyrsrsgglldvehdmealkrfdgaywrdlfdsrvgkstwpygsgvwskkewvlpeidd
    ddivsafegnsnlfwaerfgkqflgmndlwvkhcgishtgsfkdlgmtvlvsqvnrlrkm
    krpvvgvgcastgdtsaalsaycasagipsivflpankismaqlvqpiangafvlsidtd
    fdgcmklireitaelpiylanslnslrlegqktaaieilqqfdwqvpdwvivpggnlgni
    yafykgfkmcqelglvdriprmvcaqaananplylhyksgwkdfkpmtasttfasaiqig
    dpvsidravyalkkcngiveeateeelmdamaqadstgmficphtgvaltalfklrnqgv
    iaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvkadfgavmdvlksylg
    sntlts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e5xB (B:)
    phrtednirdevnpfsakyvpfnaapgstesysldeivglldvehdmealkrfdgaywrd
    lfdsrvgkstwpygsgvwskkewvlpeiddddivsafegnsnlfwaerfgkqflgmndlw
    vkhcgishtgsfkdlgmtvlvsqvnrlrkmkrpvvgvgcastgdtsaalsaycasagips
    ivflpankismaqlvqpiangafvlsidtdfdgcmklireitaelpiylanslnslrleg
    qktaaieilqqfdwqvpdwvivpggnlgniyafykgfkmcqelglvdriprmvcaqaana
    nplylhyksgwkdfkpvsidravyalkkcngiveeateeelmdamaqadstgmficphtg
    valtalfklrnqgviaptdrtvvvstahglkftqskidyhsnaipdmacrfsnppvdvka
    dfgavmdvlksyl