PDB entry 1e4w

View 1e4w on RCSB PDB site
Description: crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Deposited on 2000-07-12, released 2001-07-12
The last revision prior to the SCOP 1.65 freeze date was dated 2001-07-12, with a file datestamp of 2001-07-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4wH (H:)
    qvqlqqpgaelvkpgasvklsckasgftftnywmhwvkqrpgqglewigeilpsngrtny
    nekfktkatltvdkssntaymqlssltsedsavyycarspsdywgqgttltvssakttap
    svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
    svtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4wL (L:)
    diqmtqtpsslsaslgdrvtiscrasqdishylnwfqqkpdgtvklliyytstlhsgvps
    rfsgsgsgtdysltisnleeediafyfcqqggalpftfgsgtklaikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvldswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec