PDB entry 1e4j

View 1e4j on RCSB PDB site
Description: crystal structure of the soluble human fc-gamma receptor iii
Deposited on 2000-07-07, released 2000-08-04
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-04, with a file datestamp of 2000-08-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.1951
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e4jA (A:)
lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
dsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtyl
qngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqg