PDB entry 1e3q

View 1e3q on RCSB PDB site
Description: torpedo californica acetylcholinesterase complexed with bw284c51
Class: hydrolase
Keywords: serine hydrolase, hydrolase, inhibitor
Deposited on 2000-06-21, released 2000-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3qa_
  • Heterogens: EBW, SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3qA (A:)
    ddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwna
    stypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggf
    ysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwv
    hdniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvae
    grrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgef
    fptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsv
    phandlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyl
    yffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktg
    npnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnatacdge
    lss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3qA (A:)
    hsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnast
    ypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfys
    gsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhd
    niqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegr
    rravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffp
    tslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvph
    andlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyf
    fnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnp
    nephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat