PDB entry 1e3p

View 1e3p on RCSB PDB site
Description: tungstate derivative of streptomyces antibioticus pnpase/ gpsi enzyme
Class: polyribonucleotide transferase
Keywords: polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation
Deposited on 2000-06-20, released 2000-11-03
The last revision prior to the SCOP 1.75 freeze date was dated 2000-11-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: -1.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanosine pentaphosphate synthetase
    Species: Streptomyces antibioticus
    Gene: GPSI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53597
      • conflict (68)
      • conflict (223)
      • conflict (227)
      • conflict (230-231)
      • conflict (257)
      • conflict (275)
      • sequencing ambiguity (279)
      • conflict (288-289)
      • conflict (292)
      • conflict (296-297)
      • conflict (306)
      • conflict (316)
      • sequencing ambiguity (351)
      • conflict (629)
      • conflict (644)
      • conflict (646-647)
      • conflict (673)
      • conflict (719)
    Domains in SCOP 1.75: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7
  • Heterogens: SO4, WO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3pA (A:)
    asmtggqqmgrgsgsefmenethyaeavidngafgtrtirfetgrlarqaagsavayldd
    dtmvlsattasknpkdqldffpltvdveermyaagkipgsffrregrpsedailtcrlid
    rplrpsfkkglrneiqvvatimalnpdhlydvvainaasastqlaglpfsgpiggvrval
    irgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiqlvkdgaeaptee
    vvaagldaakpfikvlckaqadlaakaakptgefpvfldyqddvlealsaavrpelsaal
    tiagkqdreaeldrvkalaaekllpefegrekeisaayraltkslvrerviaekkridgr
    gvtdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhn
    ynfppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngsts
    mgsvcastmsllnagvplkapvagiamglisqeingethyvaltdilgaedafgdmdfkv
    agtkefvtalqldtkldgipasvlaaalkqardarlhildvmmeaidtpdemspnaprii
    tvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaeaaratingia
    nptspevgerilgsvvktttfgafvsllpgkdgllhisqirklaggkrvenvedvlgvgq
    kvqveiaeidsrgklslipviegeeaasdekkddaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3pA (A:)
    nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
    ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
    timalnpdhlydvvainaasastqlaglpfsgpiggvrvalirgqwvafpthteledavf
    dmvvagrvledgdvaimmveaeatektiqlvkdgaeapteevvaagldaakpfikvlcka
    qadlaakaakptgefpvfldyqddvlealsaavrpelsaaltiagkqdreaeldrvkala
    aekllpefegrekeisaayraltkslvrerviaekkridgrgvtdirtlaaeveaiprvh
    gsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnynfppysvgetgrvgspkr
    reighgalaeraivpvlptreefpyairqvsealgsngstsmgsvcastmsllnagvplk
    apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
    pasvlaaalkqardarlhildvmmeaidtpdemspnapriitvnqiqedtgaeiyigaad
    gpaaeagsvvkttfgafvslldgllhlgvgqkvqveiaeidsrgk