PDB entry 1e3p

View 1e3p on RCSB PDB site
Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
Deposited on 2000-06-20, released 2000-11-03
The last revision prior to the SCOP 1.71 freeze date was dated 2000-11-03, with a file datestamp of 2000-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: -1.69 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3pA (A:)
    asmtggqqmgrgsgsefmenethyaeavidngafgtrtirfetgrlarqaagsavayldd
    dtmvlsattasknpkdqldffpltvdveermyaagkipgsffrregrpsedailtcrlid
    rplrpsfkkglrneiqvvatimalnpdhlydvvainaasastqlaglpfsgpiggvrval
    irgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiqlvkdgaeaptee
    vvaagldaakpfikvlckaqadlaakaakptgefpvfldyqddvlealsaavrpelsaal
    tiagkqdreaeldrvkalaaekllpefegrekeisaayraltkslvrerviaekkridgr
    gvtdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhn
    ynfppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngsts
    mgsvcastmsllnagvplkapvagiamglisqeingethyvaltdilgaedafgdmdfkv
    agtkefvtalqldtkldgipasvlaaalkqardarlhildvmmeaidtpdemspnaprii
    tvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaeaaratingia
    nptspevgerilgsvvktttfgafvsllpgkdgllhisqirklaggkrvenvedvlgvgq
    kvqveiaeidsrgklslipviegeeaasdekkddaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3pA (A:)
    nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
    ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
    timalnpdhlydvvainaasastqlaglpfsgpiggvrvalirgqwvafpthteledavf
    dmvvagrvledgdvaimmveaeatektiqlvkdgaeapteevvaagldaakpfikvlcka
    qadlaakaakptgefpvfldyqddvlealsaavrpelsaaltiagkqdreaeldrvkala
    aekllpefegrekeisaayraltkslvrerviaekkridgrgvtdirtlaaeveaiprvh
    gsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnynfppysvgetgrvgspkr
    reighgalaeraivpvlptreefpyairqvsealgsngstsmgsvcastmsllnagvplk
    apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
    pasvlaaalkqardarlhildvmmeaidtpdemspnapriitvnqiqedtgaeiyigaad
    gpaaeagsvvkttfgafvslldgllhlgvgqkvqveiaeidsrgk