PDB entry 1e3j

View 1e3j on RCSB PDB site
Description: ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly
Class: oxidoreductase
Keywords: oxidoreductase, fructose reduction
Deposited on 2000-06-19, released 2001-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nadp(h)-dependent ketose reductase
    Species: BEMISIA ARGENTIFOLII [TaxId:77855]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e3ja1, d1e3ja2
  • Heterogens: ZN, PO4, BO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3jA (A:)
    masdnlsavlykqndlrleqrpipepkedevllqmayvgicgsdvhyyehgriadfivkd
    pmvigheasgtvvkvgknvkhlkkgdrvavepgvpcrrcqfckegkynlcpdltfcatpp
    ddgnlaryyvhaadfchklpdnvsleegalleplsvgvhacrragvqlgttvlvigagpi
    glvsvlaakaygafvvctarsprrlevakncgadvtlvvdpakeeessiierirsaigdl
    pnvtidcsgnekcitiginitrtggtlmlvgmgsqmvtvplvnacareidiksvfrycnd
    ypialemvasgrcnvkqlvthsfkleqtvdafeaarkkadntikvmiscrqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3jA (A:)
    dnlsavlykqndlrleqrpipepkedevllqmayvgicgsdvhyyehgriadfivkdpmv
    igheasgtvvkvgknvkhlkkgdrvavepgvpcrrcqfckegkynlcpdltfcatppddg
    nlaryyvhaadfchklpdnvsleegalleplsvgvhacrragvqlgttvlvigagpiglv
    svlaakaygafvvctarsprrlevakncgadvtlvvdpakeeessiierirsaigdlpnv
    tidcsgnekcitiginitrtggtlmlvgmgsqmvtvplvnacareidiksvfrycndypi
    alemvasgrcnvkqlvthsfkleqtvdafeaarkkadntikvmiscrq