PDB entry 1e3h

View 1e3h on RCSB PDB site
Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme
Deposited on 2000-06-15, released 2000-11-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-05, with a file datestamp of 2000-11-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3hA (A:)
    nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
    ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
    timalnpdhlydvvainaasastqlaglpfsgpiggvrvalirgqwvafpthteledavf
    dmvvagrvledgdvaimmveaeatektiqlvkdgaeapteevvaagldaakpfikvlcka
    qadlaakaakptgefpvfldyqddvlealsaavrpelsaaltiagkqdreaeldrvkala
    aekllpefegrekeisaayraltkslvrerviaekkridgrgvtdirtlaaeveaiprvh
    gsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnynfppysvgetgrvgspkr
    reighgalaeraivpvlptreefpyairqvsealgsngstsmgsvcastmsllnagvplk
    apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
    pasvlaaalkqardarlhildvmmeaidtpdemspnapriitvkipvdkigevigpkrqm
    inqiqedtgaeitieddgtiyigaadgpaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3hA (A:)
    nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
    ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
    timalnpdhlydvvainaasastqlaglpfsgpiggvrvalirgqwvafpthteledavf
    dmvvagrvledgdvaimmveaeatektiqlvkdgaeapteevvaagldaakpfikvlcka
    qadlaakaakptgefpvfldyqddvlealsaavrpelsaaltiagkqdreaeldrvkala
    aekllpefegrekeisaayraltkslvrerviaekkridgrgvtdirtlaaeveaiprvh
    gsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnynfppysvgetgrvgspkr
    reighgalaeraivpvlptreefpyairqvsealgsngstsmgsvcastmsllnagvplk
    apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
    pasvlaaalkqardarlhildvmmeaidtpdemspnapriiqiqedtgaeiyigaadgpa
    a