PDB entry 1e15

View 1e15 on RCSB PDB site
Description: chitinase b from serratia marcescens
Deposited on 2000-04-18, released 2000-08-18
The last revision prior to the SCOP 1.57 freeze date was dated 2000-08-18, with a file datestamp of 2000-08-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e15A (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e15B (B:)
    rkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecawd
    patndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrakf
    aqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlti
    agaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfynal
    reanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsggn
    ggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndkt
    ktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryfn
    aadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyit
    sapgsdsawlkvgrva