PDB entry 1e14

View 1e14 on RCSB PDB site
Description: photosynthetic reaction center mutant with phe m197 replaced with arg (chain m, fm197r) and gly m203 replaced with asp (chain m, gm203d)
Class: electron transport
Keywords: transmembrane, electron transport, photosynthesis
Deposited on 2000-04-18, released 2000-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Photosynthetic reaction center H subunit
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: PUFQLMX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e14h1, d1e14h2
  • Chain 'L':
    Compound: Photosynthetic reaction center L subunit
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: PUFQLMX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e14l_
  • Chain 'M':
    Compound: Photosynthetic reaction center M subunit
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: PUFQLMX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02953 (0-End)
      • engineered mutation (196)
      • engineered mutation (202)
    Domains in SCOPe 2.07: d1e14m_
  • Heterogens: BCL, BPH, FE, U10, SPN, LDA, CDL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1e14H (H:)
    mvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e14H (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    v
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e14L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1e14M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlrynpfhdlsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e14M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlrynpfhdlsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgm