PDB entry 1e0z

View 1e0z on RCSB PDB site
Description: [2fe-2s]-ferredoxin from halobacterium salinarum
Class: electron transport
Keywords: electron transport, iron-sulfur protein, nmr, ferredoxin, halophilic
Deposited on 2000-04-11, released 2001-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: HALOBACTERIUM SALINARIUM [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e0za_
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0zA (A:)
    ptveylnyetlddqgwdmddddlfekaadagldgedygtmevaegeyileaaeaqgydwp
    fscragacancasivkegeidmdmqqilsdeeveekdvrltcigspaadevkivynakhl
    dylqnrvi