PDB entry 1e0p

View 1e0p on RCSB PDB site
Description: l intermediate of bacteriorhodopsin
Deposited on 2000-04-04, released 2000-08-19
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-19, with a file datestamp of 2000-08-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.265
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e0pa_
  • Chain 'B':
    Domains in SCOP 1.61: d1e0pb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0pA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e0pB (B:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge