PDB entry 1e0b

View 1e0b on RCSB PDB site
Description: chromo shadow domain from fission yeast swi6 protein.
Deposited on 2000-03-16, released 2000-05-12
The last revision prior to the SCOP 1.61 freeze date was dated 2001-06-14, with a file datestamp of 2001-06-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e0ba_
  • Chain 'B':
    Domains in SCOP 1.61: d1e0bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e0bA (A:)
qvenydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyesh
l

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e0bB (B:)
ydswedlvssidtierkddgtleiyltwkngaishhpstitnkkcpqkmlqfyeshltf