PDB entry 1dzo

View 1dzo on RCSB PDB site
Description: truncated pak pilin from pseudomonas aeruginosa
Deposited on 2000-03-06, released 2000-06-11
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-11, with a file datestamp of 2000-06-11.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.153
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1dzoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzoA (A:)
    alegtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadank
    lgtialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkg
    csr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzoA (A:)
    gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
    ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr