PDB entry 1dzl

View 1dzl on RCSB PDB site
Description: l1 protein of human papillomavirus 16
Class: virus
Keywords: virus, icosahedral
Deposited on 2000-03-01, released 2000-03-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.28
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: late major capsid protein l1
    Species: Human papillomavirus type 16 [TaxId:333760]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WPH4
      • conflict (176)
      • conflict (180)
      • conflict (257)
      • conflict (265)
      • engineered (471)
    Domains in SCOPe 2.03: d1dzla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzlA (A:)
    mslwlpseatvylppvpvskvvstdeyvartniyyhagtsrllavghpyfpikkpnnnki
    lvpkvsglqyrvfrihlpdpnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisgh
    pllnklddtenasayaanagvdnrecismdykqtqlcligckppigehwgkgspctqvav
    qpgdcpplelintviqdgdmvdtgfgamdfttlqanksevpldictsickypdyikmvse
    pygdslffylrreqmfvrhlfnragtvgenvpddlyikgsgstanlassnyfptpsgsmv
    tsdaqifnkpywlqraqghnngicwgnqlfvtvvdttrstnmslcaaistsettykntnf
    keylrhgeeydlqfifqlckitltadvmtyihsmnstiledwnfglqpppggtledtyrf
    vtsqaiacqkhtppapkedplkkytfwevnlkekfsadldqfplgrkfllqlglkakpkf
    tlgkrkatpttsststtakrkkrkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzlA (A:)
    kvvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwnfglqpppggtledtyrfvtsqaiacqkhtppapked
    plkkytfwevnlkekfsadldqfplgrkfllqlgl