PDB entry 1dz7

View 1dz7 on RCSB PDB site
Description: solution structure of the a-subunit of human chorionic gonadotropin [modeled without carbohydrate residues]
Class: glycoprotein
Keywords: chorionic gonadotropin, chorionic gonadotropin free a subunit, glycoprotein structure, cystine knot, nmr, xplor
Deposited on 2000-02-18, released 2000-02-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR27
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chorionic gonadotropin
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01215 (0-91)
  Domains in SCOP 1.75: d1dz7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dz7A (A:)
  apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
  vaksynrvtvmggfkvenhtachcstcyyhks