PDB entry 1dz7

View 1dz7 on RCSB PDB site
Description: solution structure of the a-subunit of human chorionic gonadotropin [modeled without carbohydrate residues]
Deposited on 2000-02-18, released 2000-02-29
The last revision prior to the SCOP 1.71 freeze date was dated 2000-04-22, with a file datestamp of 2000-04-22.
Experiment type: NMR27
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1dz7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dz7A (A:)
  apdvqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
  vaksynrvtvmggfkvenhtachcstcyyhks