PDB entry 1dz5

View 1dz5 on RCSB PDB site
Description: The NMR structure of the 38KDa U1A protein-PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein
Class: ribonucleoprotein/RNA
Keywords: ribonucleoprotein-RNA complex, polyadenylation, protein protein interaction, RNA protein interaction
Deposited on 2000-02-16, released 2000-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (0-100)
    • engineered mutation (29)
    • engineered mutation (34)
  Domains in SCOPe 2.06: d1dz5a_
• Chain 'B':
  Compound: U1 small nuclear ribonucleoprotein A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (0-100)
    • engineered mutation (29)
    • engineered mutation (34)
  Domains in SCOPe 2.06: d1dz5b_
• Chain 'C':
  Compound: pie, RNA (5'-r(*gp*ap*gp*ap*cp*ap*up*up*gp*cp*ap*cp*cp* cp*gp*gp*ap*gp*up*cp*up*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  
• Chain 'D':
  Compound: pie, RNA (5'-r(*gp*ap*gp*ap*cp*ap*up*up*gp*cp*ap*cp*cp* cp*gp*gp*ap*gp*up*cp*up*c)-3')
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dz5A (A:)
  avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
  vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dz5B (B:)
  avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
  vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.