PDB entry 1dz5

View 1dz5 on RCSB PDB site
Description: The NMR structure of the 38KDa U1A protein-PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein
Deposited on 2000-02-16, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: NMR13
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dz5a_
  • Chain 'B':
    Domains in SCOP 1.55: d1dz5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dz5A (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dz5B (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv