PDB entry 1dyv

View 1dyv on RCSB PDB site
Description: crystal structure of circularly permuted cpdsba_q100t99
Deposited on 2000-02-09, released 2000-02-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-21, with a file datestamp of 2003-05-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.232
AEROSPACI score: -1.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dyvA (A:)
    qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
    qlnpqgmdtsnmdvfvqqyadtvkylsekkgggtgaqyedgkqyttlekpvagapqvlef
    fsffcphcyqfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgve
    dkvtvplfegvqktlik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dyvA (A:)
    qtirsasdirdvfinagikgeeydaawnsfvvkslvaqqekaaadvqlrgvpamfvngky
    qlnpqgmdtsnmdvfvqqyadtvkylseyedgkqyttlekpvagapqvleffsffcphcy
    qfeevlhisdnvkkklpegvkmtkyhvnfmggdlgkdltqawavamalgvedkvtvplfe
    gvqktl