PDB entry 1dyq

View 1dyq on RCSB PDB site
Description: staphylococcal enterotoxin a mutant vaccine
Class: enterotoxin
Keywords: enterotoxin, staphylococcal enterotoxin type a, vaccine
Deposited on 2000-02-05, released 2001-03-19
The last revision prior to the SCOP 1.73 freeze date was dated 2002-02-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: -1.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal enterotoxin a mutant
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0L2 (Start-233)
      • engineered (48)
      • engineered (70)
      • engineered (92)
    Domains in SCOP 1.73: d1dyqa1, d1dyqa2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dyqA (A:)
    msekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfft
    dhswyndllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrl
    teekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkv
    qrglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dyqA (A:)
    einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn
    dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlteekkv
    pinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrgliv
    fhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts