PDB entry 1dyq

View 1dyq on RCSB PDB site
Description: staphylococcal enterotoxin a mutant vaccine
Deposited on 2000-02-05, released 2001-03-19
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-21, with a file datestamp of 2002-02-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: -1.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dyqA (A:)
    msekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfft
    dhswyndllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrl
    teekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkv
    qrglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dyqA (A:)
    einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn
    dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlteekkv
    pinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrgliv
    fhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts