PDB entry 1dy8

View 1dy8 on RCSB PDB site
Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (inhibitor ii)
Deposited on 2000-01-31, released 2001-01-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-28, with a file datestamp of 2002-03-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1dy8.1
  • Chain 'B':
    Domains in SCOP 1.61: d1dy8.2
  • Chain 'C':
    Domains in SCOP 1.61: d1dy8.1
  • Chain 'D':
    Domains in SCOP 1.61: d1dy8.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy8A (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy8B (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy8C (C:)
    gsvvivgriils
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy8D (D:)
    gsvvivgriils