PDB entry 1dxy

View 1dxy on RCSB PDB site
Description: structure of d-2-hydroxyisocaproate dehydrogenase
Deposited on 1996-08-13, released 1997-06-16
The last revision prior to the SCOP 1.59 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxy_ (-)
    mkiiaygarvdeiqyfkqwakdtgntleyhtefldentvewakgfdginslqttpyaagv
    fekmhaygikfltirnvgtdnidmtamkqygirlsnvpayspaaiaefaltdtlyllrnm
    gkvqaqlqagdyekagtfigkelgqqtvgvmgtghigqvaiklfkgfgakviaydpypmk
    gdhpdfdyvsledlfkqsdvidlhvpgieqnthiineaafnlmkpgaivintarpnlidt
    qamlsnlksgklagvgidtyeyetedllnlakhgsfkdplwdellgmpnvvlsphiayyt
    etavhnmvyfslqhlvdfltkgetstevtg