PDB entry 1dxw

View 1dxw on RCSB PDB site
Description: structure of hetero complex of non structural protein (ns) of hepatitis c virus (hcv) and synthetic peptidic compound
Deposited on 2000-01-17, released 2001-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-12, with a file datestamp of 2001-01-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1dxwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dxwA (A:)
  tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
  lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
  pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk