PDB entry 1dxp

View 1dxp on RCSB PDB site
Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)
Deposited on 2000-01-13, released 2001-01-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-25, with a file datestamp of 2004-03-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dxp.1
  • Chain 'B':
    Domains in SCOP 1.71: d1dxp.2
  • Chain 'C':
    Domains in SCOP 1.71: d1dxp.1
  • Chain 'D':
    Domains in SCOP 1.71: d1dxp.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxpA (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpA (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dxpB (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpB (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dxpC (C:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpC (C:)
    gsvvivgriils
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dxpD (D:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpD (D:)
    gsvvivgriils