PDB entry 1dxd

View 1dxd on RCSB PDB site
Description: photolyzed co complex of myoglobin mb-yqr at 20k
Class: oxygen storage
Keywords: oxygen storage, co complex, respiratory protein
Deposited on 2000-01-03, released 2000-03-27
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.133
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • engineered (29)
    • engineered (64)
    • engineered (67)
    • engineered (122)
  Domains in SCOP 1.73: d1dxda_
• Heterogens: SO4, HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dxdA (A:)
  mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
  dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg