PDB entry 1dx8

View 1dx8 on RCSB PDB site
Description: rubredoxin from guillardia theta
Class: electron transport
Keywords: electron transport, nmr, rubredoxin, guillardia theta, zinc-substitution
Deposited on 1999-12-23, released 2000-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: GUILLARDIA THETA [TaxId:55529]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9XG40 (0-69)
  Domains in SCOPe 2.06: d1dx8a_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dx8A (A:)
  meidegkyeceacgyiyepekgdkfagippgtpfvdlsdsfmcpacrspknqfksikkvi
  agfaenqkyg