PDB entry 1dx8

View 1dx8 on RCSB PDB site
Description: rubredoxin from guillardia theta
Deposited on 1999-12-23, released 2000-01-04
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-12, with a file datestamp of 2000-09-12.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1dx8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dx8A (A:)
  meidegkyeceacgyiyepekgdkfagippgtpfvdlsdsfmcpacrspknqfksikkvi
  agfaenqkyg