PDB entry 1dx4

View 1dx4 on RCSB PDB site
Description: ache from drosophila melanogaster complex with tacrine derivative 9-(3-phenylmethylamino)-1,2,3,4-tetrahydroacridine
Class: hydrolase
Keywords: hydrolase, serine esterase, synapse, membrane, nerve, muscle, neurotransmitter degradation, glycoprotein, gpi-anchor
Deposited on 1999-12-20, released 2000-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dx4a_
  • Heterogens: SO4, NAG, 760, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dx4A (A:)
    vidrlvvqtssgpvrgrsvtvqgrevhvytgipyakppvedlrfrkpvpaepwhgvldat
    glsatcvqeryeyfpgfsgeeiwnpntnvsedclyinvwapakarlrhgrganggehpng
    kqadtdhlihngnpqnttnglpiliwiygggfmtgsatldiynadimaavgnvivasfqy
    rvgafgflhlapempsefaeeapgnvglwdqalairwlkdnahafggnpewmtlfgesag
    sssvnaqlmspvtrglvkrgmmqsgtmnapwshmtsekaveigkalindcncnasmlktn
    pahvmscmrsvdaktisvqqwnsysgilsfpsaptidgaflpadpmtlmktadlkdydil
    mgnvrdegtyfllydfidyfdkddatalprdkyleimnnifgkatqaereaiifqytswe
    gnpgyqnqqqigravgdhfftcptneyaqalaergasvhyyyfthrtstslwgewmgvlh
    gdeieyffgqplnnslqyrpverelgkrmlsaviefaktgnpaqdgeewpnfskedpvyy
    ifstddkieklargplaarcsfwndylpkvrswagtcdgdsgsas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dx4A (A:)
    drlvvqtssgpvrgrsvtvqgrevhvytgipyakppvedlrfrkpvpaepwhgvldatgl
    satcvqeryeyfpgfsgeeiwnpntnvsedclyinvwapattnglpiliwiygggfmtgs
    atldiynadimaavgnvivasfqyrvgafgflhlapempsefaeeapgnvglwdqalair
    wlkdnahafggnpewmtlfgesagsssvnaqlmspvtrglvkrgmmqsgtmnapwshmts
    ekaveigkalindcncnasmlktnpahvmscmrsvdaktisvqqwnsysgilsfpsapti
    dgaflpadpmtlmktadlkdydilmgnvrdegtyfllydfidyfdkddatalprdkylei
    mnnifgkatqaereaiifqytswegnpgyqnqqqigravgdhfftcptneyaqalaerga
    svhyyyfthrtstslwgewmgvlhgdeieyffgqplnnslqyrpverelgkrmlsavief
    aktgnpaqdgeewpnfskedpvyyifstddkieklargplaarcsfwndylpkvrsw