PDB entry 1dvv

View 1dvv on RCSB PDB site
Description: solution structure of the quintuple mutant of cytochrome c-551 from pseudomonas aeruginosa
Class: electron transport
Keywords: cytochrome c, stability, ELECTRON TRANSPORT
Deposited on 2000-01-22, released 2000-11-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00099 (0-81)
      • mutation (6)
      • mutation (12)
      • mutation (33)
      • mutation (42)
      • mutation (77)
    Domains in SCOPe 2.04: d1dvva_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvvA (A:)
    edpevlaknkgcmachaidtkmvgpaykdvaakyagqagaeaylaqrikngsqgvwgpip
    mppnavsddeaqtlakwilsqk