PDB entry 1dvv

View 1dvv on RCSB PDB site
Description: solution structure of the quintuple mutant of cytochrome c-551 from pseudomonas aeruginosa
Class: electron transport
Keywords: cytochrome c, stability
Deposited on 2000-01-22, released 2000-11-29
The last revision prior to the SCOP 1.75 freeze date was dated 2000-11-29, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c551
  Species: Pseudomonas aeruginosa
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00099 (0-81)
    • mutation (6)
    • mutation (12)
    • mutation (33)
    • mutation (42)
    • mutation (77)
  Domains in SCOP 1.75: d1dvva_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dvvA (A:)
  edpevlaknkgcmachaidtkmvgpaykdvaakyagqagaeaylaqrikngsqgvwgpip
  mppnavsddeaqtlakwilsqk