PDB entry 1dvv

View 1dvv on RCSB PDB site
Description: solution structure of the quintuple mutant of cytochrome c-551 from pseudomonas aeruginosa
Deposited on 2000-01-22, released 2000-11-29
The last revision prior to the SCOP 1.63 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1dvva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvvA (A:)
    edpevlaknkgcmachaidtkmvgpaykdvaakyagqagaeaylaqrikngsqgvwgpip
    mppnavsddeaqtlakwilsqk