PDB entry 1dv6

View 1dv6 on RCSB PDB site
Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+
Deposited on 2000-01-19, released 2000-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6H (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaaml
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6M (M:)
    yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
    glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
    fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
    ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
    taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6R (R:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6S (S:)
    yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
    glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
    fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
    ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
    taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6T (T:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaaml