PDB entry 1dv6

View 1dv6 on RCSB PDB site
Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+
Class: photosynthesis
Keywords: Bacterial Photosynthesis, Rhodobacter sphaeroides, Metal Ion Binding, Cation Binding, Proton Transfer, Integral Membrane Protein, PHOTOSYNTHESIS
Deposited on 2000-01-19, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv6h1, d1dv6h2
  • Chain 'L':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv6l_
  • Chain 'M':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv6m_
  • Chain 'R':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv6r_
  • Chain 'S':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv6s_
  • Chain 'T':
    Compound: photosynthetic reaction center
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv6t1, d1dv6t2
  • Heterogens: FE2, ZN, CL, BCL, BPH, U10, LDA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dv6H (H:)
    mvgvtafqnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv6H (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaaml
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1dv6M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv6M (M:)
    yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
    glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
    fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
    ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
    taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv6R (R:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1dv6S (S:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv6S (S:)
    yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
    glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
    fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
    ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
    taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1dv6T (T:)
    mvgvtafqnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpk
    pktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdl
    peldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarfle
    velkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagg
    lmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv6T (T:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    vvaaml