PDB entry 1dv0

View 1dv0 on RCSB PDB site
Description: refined nmr solution structure of the c-terminal uba domain of the human homologue of rad23a (hhr23a)
Deposited on 2000-01-19, released 2000-02-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-11, with a file datestamp of 2000-02-11.
Experiment type: NMR18
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dv0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv0A (A:)
    qekeaierlkalgfpeslviqayfaceknenlaanfllsqnfdde