PDB entry 1du3

View 1du3 on RCSB PDB site
Description:
Deposited on 2000-01-14, released 2000-09-27
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-27, with a file datestamp of 2000-09-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.291
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3a1, d1du3a2, d1du3a3
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3b1, d1du3b2, d1du3b3
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3c1, d1du3c2, d1du3c3
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3d_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3e_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3f_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3g1, d1du3g2, d1du3g3
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3h1, d1du3h2, d1du3h3
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3i1, d1du3i2, d1du3i3
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3j_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3k_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d1du3l_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1du3A (A:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3A (A:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du3B (B:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhkes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1du3C (C:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3C (C:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1du3D (D:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3D (D:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1du3E (E:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3E (E:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1du3F (F:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3F (F:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du3G (G:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1du3H (H:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3H (H:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1du3I (I:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3I (I:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1du3J (J:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3J (J:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1du3K (K:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3K (K:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1du3L (L:)
    qrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihek
    gfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeygl
    ysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3L (L:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg