PDB entry 1dtp

View 1dtp on RCSB PDB site
Description: the structure of the isolated catalytic domain of diphtheria toxin
Class: toxin
Keywords: toxin
Deposited on 1994-09-08, released 1994-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin
    Species: Corynephage beta [TaxId:10703]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dtpa_
  • Heterogens: APU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dtpA (A:)
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
ymaqacagnr