PDB entry 1dtm

View 1dtm on RCSB PDB site
Description: crystal structure of the sperm-whale myoglobin mutant h93g complexed with 4-methylimidazole, metaquo form
Class: oxygen storage/transport
Keywords: Heme protein, Myoglobin, ligand-substitution, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-01-12, released 2000-02-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombinant sperm whale myoglobin variant h93g
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-End)
      • mutation (92)
    Domains in SCOPe 2.01: d1dtma_
  • Heterogens: HEM, 4MZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtmA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtmA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyq