PDB entry 1dth

View 1dth on RCSB PDB site
Description: metalloprotease
Deposited on 1996-02-12, released 1997-02-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dtha_
  • Chain 'B':
    Domains in SCOP 1.55: d1dthb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dthA (A:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dthB (B:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp