PDB entry 1dt1

View 1dt1 on RCSB PDB site
Description: thermus thermophilus cytochrome c552 synthesized by escherichia coli
Class: oxidoreductase
Keywords: Cytochrome C552, Thermus thermophilus
Deposited on 2000-01-10, released 2000-02-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.204
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c552
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SME3 (0-128)
  Domains in SCOP 1.75: d1dt1a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dt1A (A:)
  dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
  mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
  aerkklglk