PDB entry 1dsx

View 1dsx on RCSB PDB site
Description: kv1.2 t1 domain, residues 33-119, t46v mutant
Class: signaling protein
Keywords: voltage-gated potassium channel, assembly domain, tetramer, signaling protein
Deposited on 2000-01-10, released 2000-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.237
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxa_
• Chain 'B':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxb_
• Chain 'C':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxc_
• Chain 'D':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxd_
• Chain 'E':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxe_
• Chain 'F':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxf_
• Chain 'G':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxg_
• Chain 'H':
  Compound: protein (kv1.2 voltage-gated potassium channel)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63142 (0-86)
    • engineered (13)
  Domains in SCOPe 2.05: d1dsxh_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxA (A:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxB (B:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxC (C:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxD (D:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxE (E:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxF (F:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxG (G:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsxH (H:)
  ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
  qsggrlrrpvnvpldifseeirfyelg