PDB entry 1dsx

View 1dsx on RCSB PDB site
Description: kv1.2 t1 domain, residues 33-119, t46v mutant
Deposited on 2000-01-10, released 2000-09-20
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.237
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dsxa_
  • Chain 'B':
    Domains in SCOP 1.57: d1dsxb_
  • Chain 'C':
    Domains in SCOP 1.57: d1dsxc_
  • Chain 'D':
    Domains in SCOP 1.57: d1dsxd_
  • Chain 'E':
    Domains in SCOP 1.57: d1dsxe_
  • Chain 'F':
    Domains in SCOP 1.57: d1dsxf_
  • Chain 'G':
    Domains in SCOP 1.57: d1dsxg_
  • Chain 'H':
    Domains in SCOP 1.57: d1dsxh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxA (A:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxB (B:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxC (C:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxD (D:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxE (E:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxF (F:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxG (G:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxH (H:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg